GLP-1/Glucagon-Like Peptide, human

GLP-1/Glucagon-Like Peptide, human corresponds to the human GLP-1 sequence used in receptor-binding and structural studies. The peptide encompasses key residues for helix formation and G protein-coupled receptor activation. Researchers employ it to examine ligand-induced conformational changes and enzymatic cleavage. Its native sequence is a cornerstone for GLP-1 biology research.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: G16010

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C186H275N51O59
M.W/Mr.
4169.6
Sequence
DEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Length
36

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOPeptide Modification ServicesPeptide Synthesis ServicesCustom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide Analysis ServicescGMP Peptide ServiceEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers