CAT# | H01002 |
M.F/Formula | C176H283N45O51 |
M.W/Mr. | 3845.46 |
Sequence | HSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPP-NH2 |
Length | 35 |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...
Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...
As a small actin-binding protein upregulated in highly metastatic prostate cancer cells, thymosin β15 (Tβ15) has ...
Myristoyl pentapeptide-8, a cosmetic peptide, is a synthetic peptide containing arginine, aspartic acid, glycine ...