Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 3355.7 |
Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
Length | 31 |
2. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.