We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4442.1 |
Sequence | DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA |
Length | 42 |
1. High fat diet and GLP-1 drugs induce pancreatic injury in mice
2. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.