CAT# | G09010 |
M.F/Formula | C219H365N73O66S |
M.W/Mr. | 5108.83 |
Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2 |
Length | 44 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
G09014 | Growth Hormone (6-13), human | Inquiry | ||
G09009 | GRF (free acid) (human) | Inquiry | ||
G09007 | GRF, mouse | Inquiry | ||
G09008 | Growth Hormone Releasing Factor, GRF (1 - 44), amide, human | Inquiry | ||
G09011 | GRF (ovine, caprine) | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Histrelin acetate, sold under many brand name like Vantas, Supprelin LA and others, is a nonapeptide analog of g ...
Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...
Cyclotraxin B , a potent antagonist of TrkB receptors, inhibits BDNF-induced TrkB activity (IC50 = 0.30 nM). R ...
Delcasertib, also known as KAI-9803, is a 23-amino acid peptide and δ-protein kinase C (δ-PKC) inhibitor. KAI-9 ...
Myristoyl pentapeptide-8, a cosmetic peptide, is a synthetic peptide containing arginine, aspartic acid, glycine ...