hBD-1,β-Defensin-1, human

This is a 3.9kDa 36-amino acid peptide called beta-Defensin-1 (hBD-1) having a beta sheet with three intramolecular disulfide bonds. It is constitutively produced by various epithelial tissues including urogenital and respiratory tracts. It's expression is also inducible in keratinocytes of whole human skin by lipopolysaccharides and peptidoglycan. hBD-1 exhibits antimicrobial activity against several pathogenic microorganisms including E.coli, although its activity is dependent on salt sensitivity, because it is inhibited by salt in a concentration-dependent manner. In addition to its antimicrobial activity, hBD-1 chemoattracts CC chemokine receptor (CCR)6-expressing HEK293 cells, implying that this peptide utilizes CCR6 as a receptor.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: X21136

Synonyms/Alias:Human beta-defensin-1;452274-53-2

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C167H256N48O50S6
M.W/Mr.
3928.7
Sequence
One Letter Code: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5-34, 12-27, 17-35)
Three Letter Code: H-Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys-OH (Disulfide bridge: 5-34,12-27,17-35)
InChI
InChI=1S/C167H256N48O50S6/c1-13-83(7)131-161(259)192-102(48-50-122(173)224)139(237)183-70-128(230)210-133(87(11)219)163(261)208-118-77-268-266-75-116-155(253)195-105(58-81(3)4)145(243)196-108(62-92-40-46-96(223)47-41-92)148(246)202-113(72-217)152(250)186-86(10)136(234)209-120(165(263)215-57-27-35-121(215)159(257)213-132(84(8)14-2)162(260)200-109(59-89-28-16-15-17-29-89)151(249)214-134(88(12)220)164(262)191-101(144(242)212-131)32-20-24-54-170)79-271-270-74-115(154(252)193-104(166(264)265)33-21-25-55-171)207-157(255)117(204-142(240)100(31-19-23-53-169)189-135(233)85(9)185-141(239)99(30-18-22-52-168)187-127(229)69-182-138(236)98(34-26-56-179-167(176)177)190-146(244)106(198-156(118)254)60-90-36-42-94(221)43-37-90)76-267-269-78-119(158(256)211-130(82(5)6)160(258)203-114(73-218)153(251)201-112(71-216)140(238)181-67-125(227)180-68-126(228)188-103(143(241)205-116)49-51-123(174)225)206-150(248)111(65-124(175)226)199-147(245)107(61-91-38-44-95(222)45-39-91)197-149(247)110(63-93-66-178-80-184-93)194-137(235)97(172)64-129(231)232/h15-17,28-29,36-47,66,80-88,97-121,130-134,216-223H,13-14,18-27,30-35,48-65,67-79,168-172H2,1-12H3,(H2,173,224)(H2,174,225)(H2,175,226)(H,178,184)(H,180,227)(H,181,238)(H,182,236)(H,183,237)(H,185,239)(H,186,250)(H,187,229)(H,188,228)(H,189,233)(H,190,244)(H,191,262)(H,192,259)(H,193,252)(H,194,235)(H,195,253)(H,196,243)(H,197,247)(H,198,254)(H,199,245)(H,200,260)(H,201,251)(H,202,246)(H,203,258)(H,204,240)(H,205,241)(H,206,248)(H,207,255)(H,208,261)(H,209,234)(H,210,230)(H,211,256)(H,212,242)(H,213,257)(H,214,249)(H,231,232)(H,264,265)(H4,176,177,179)/t83-,84-,85-,86-,87+,88+,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,130-,131-,132-,133-,134-/m0/s1
InChI Key
CLAFBNXESHRGJL-YYSGPKNVSA-N
References
Niyonsaba F and Ogawa H. J Derm Sci. 40, 157-168 (2005).

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicesCustom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide Analysis ServicesPeptide CDMOPeptide Synthesis ServicesPeptide Modification ServicescGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers