hBD-1,β-Defensin-1, human
hBD-1,β-Defensin-1, human
This is a 3.9kDa 36-amino acid peptide called beta-Defensin-1 (hBD-1) having a beta sheet with three intramolecular disulfide bonds. It is constitutively produced by various epithelial tissues including urogenital and respiratory tracts. It's expression is also inducible in keratinocytes of whole human skin by lipopolysaccharides and peptidoglycan. hBD-1 exhibits antimicrobial activity against several pathogenic microorganisms including E.coli, although its activity is dependent on salt sensitivity, because it is inhibited by salt in a concentration-dependent manner. In addition to its antimicrobial activity, hBD-1 chemoattracts CC chemokine receptor (CCR)6-expressing HEK293 cells, implying that this peptide utilizes CCR6 as a receptor.
Online Inquiry
| CAT# | X21136 |
| M.W/Mr. | 3928.7 |
| Sequence | One Letter Code: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5-34, 12-27, 17-35)
Three Letter Code: H-Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys-OH (Disulfide bridge: 5-34,12-27,17-35) |
Write a review
Ask a question
My Review for hBD-1,β-Defensin-1, human
Required fields are marked with *
×
Ask a Question for hBD-1,β-Defensin-1, human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
