Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | DFGCARGMIFVCMRRCARMYPGSTGYCQGFRCMCDTMIPIRRPPFIMG |
Activity | Gram+ & Gram-, Fungi, |
Host Chemicals | the tick, Haemaphysalis longicornis |
Length | 48 |
1. Implications of ligand-receptor binding kinetics on GLP-1R signalling
2. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
4. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.