Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | FELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP |
Activity | Gram+ & Gram-, Chemotactic, |
Host Chemicals | skin, Homo sapiens |
Length | 49 |
2. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
3. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
5. Implications of ligand-receptor binding kinetics on GLP-1R signalling
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.