Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | RWKVFKKIEKVGRHIRDGVIKAGPAITVVGQATAL |
Activity | Antibacterial |
Host Chemicals | Hyphantria cunea |
Length | 35 |
SwissProt ID | P50723 |
1. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
3. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.