CAT# | I04001 |
M.F/Formula | C226H361N75O64S2 |
M.W/Mr. | 5216.95 |
Sequence | PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2 |
Length | 47 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
I04004 | Intermedin (human) trifluoroacetate salt | Inquiry | ||
I04005 | Intermedin (rat) trifluoroacetate salt | Inquiry | ||
I04006 | Intermedin-53 (human) trifluoroacetate salt | Inquiry | ||
I04002 | Intermedin (human) | Inquiry | ||
I04003 | Biotinyl-Intermedin (rat) | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...
Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...
MSG 606 (Cyclo-[(CH2) 3CO-Gly-His-D-Phe-Arg-D-Trp-Cys(S-)]-Asp-Arg-Phe-Gly-NH2) is a potent and novel cyclic thi ...
NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...
PBP 10 (RhoB-Glu-Arg-Leu-Phe-Glc-Val-Lys-Glc-Arg-Arg) is a 10-aa-long rhodamine-linked and membrane-permeable pe ...