Home > Product > Catalog Peptides > Others > Intermedin (rat)

Others

Intermedin (rat)

Price Inquiry
CAT#
I04001
Sequence
PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2
M.W/Mr.
5216.95
Molecular Formula
C226H361N75O64S2
Length
47

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.