Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C226H361N75O64S2 |
M.W/Mr. | 5216.95 |
Sequence | PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2 |
Length | 47 |
2. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
3. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
5. Myotropic activity of allatostatins in tenebrionid beetles
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.