Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | FFSASCVPGADKGQFPNLCRLCAGTGENKCA |
Activity | Antibacterial |
Host Chemicals | Synthetic construct |
Length | 31 |
3. Implications of ligand-receptor binding kinetics on GLP-1R signalling
4. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
5. TMEM16F and dynamins control expansive plasma membrane reservoirs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.