Home > Product > Antimicrobial Peptides > Lactocin 705

Antimicrobial Peptides

Lactocin 705

Price Inquiry
CAT#
AF2258
Sequence
GMSGYIQGIPDFLKGYLHGISAANKHKKGRLGY
Host Chemicals
Lactobacillus casei CRL 705
Length
33
Activity
Antimicrobial

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.