Keywords Search Google Search Search

Latescidin 1

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2728
Sequence	LEEAGSNDTPVAAHQEMSMESWMMPNHIRQKRQSHLSL
Activity	Antimicrobial

CAT#	Product Name	Inquiry
AF1232	Antimicrobial peptide brevinin-1E-OG7	Inquiry
AF3166	Defensin Tk-AMP-D4	Inquiry
AF1787	Cliotide T3	Inquiry
AF1638	Lantibiotic nukacin precursor	Inquiry
AF2634	Esculentin-2-OR4	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of perindopril erbumine in hypertension

Perindopril erbumine is an angiotensioncon vertingenzyme (ACE) inhibitor without sulfhydryl group. It is a chi ...

Function of Pep2m in Reducing AMPA Currents

Pep2m, a peptide inhibitor of GluA2 subunit binding to NSF, reduces α-amino- 3-hydroxy-5-methyl-isoxazolepropion ...

Novel Peptide Drugs to Treat Multiple Diseases (Part Two)

5. Synthetic Peptides Targeting CD36 Attenuate Lipopolysaccharide-Induced InflammationSynthetic amphipathic helical peptides ...

KAI-1678: A novel PKC-epsilon inhibitor

KAI-1678, a synthetic 21-amino acid, is a novel PKC-epsilon (ε-PKC) inhibitor with a molecular weight of 2541 Da ...

Methamphetamine and Substance P

Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Lates calcarifer
Length	38
SwissProt ID	G3FZS7