Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
Sequence | LRRIARMTPLWRIMNSKPFGAYCQNNYECSTGLCRAGHCSTS |
Activity | Antimicrobial |
Host Chemicals | Larimichthys crocea |
Length | 42 |
SwissProt ID | H9BB31 |
1. Myotropic activity of allatostatins in tenebrionid beetles
2. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.