Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM).
CAT# | R1484 |
CAS | 320367-13-3 |
Synonyms/Alias | ZP-10(Des-Pro³⁸)-Exendin-4(-Lys)₆ amide |
M.F/Formula | C₂₁₅H₃₄₇N₆₁O₆₅S |
M.W/Mr. | 4858.49 |
Sequence | One Letter Code: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 three Letter Code: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2 |
Storage | Desiccate at -20°C | Shipping Condition | Room temperature in continental US; may vary elsewhere. |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
R0845 | Calcineurin Autoinhibitory Peptide | Inquiry | ||
R1874 | (R)-MG132 | Inquiry | ||
R1453 | Insulin(cattle) | Inquiry | ||
R1414 | Hemorphin-7 | Inquiry | ||
HB00046 | Fitc-YVAD-FMK | Inquiry |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).