- Home
- COVID-19
- Services
- Products
- Research Areas
- Company
- Resources
- Ordering
Tetracosactide is a synthetic peptide, which corresponds to the first 24 amino acids of the naturally occurring hormone ACTH (adrenocorticotropic hormone). It stimulates the adrenal cortex to produce corticosteroids, mineralocorticoids, and, to a lesser extent, androgens.
| CAT# | R1484 |
| Explanation | Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM). |
| Synonyms/Alias | ZP-10(Des-Pro³⁸)-Exendin-4(-Lys)₆ amide |
| M.F/Formula | C₂₁₅H₃₄₇N₆₁O₆₅S |
| M.W/Mr. | 4858.49 |
| Sequence | One Letter Code: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 three Letter Code: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2 |
| Shipping Condition | Room temperature in continental US; may vary elsewhere. |
| CAT# | Product Name | M.W | Molecular Formula | Inquiry |
|---|---|---|---|---|
| R1140 | 3X FLAG peptide TFA | Inquiry | ||
| R1592 | PACAP (1-38), human, ovine, rat TFA | Inquiry | ||
| R1347 | Exendin-3 | Inquiry | ||
| R1544 | Neuropeptide Y (13-36), amide, human | Inquiry | ||
| R1007 | Conantokin-T | Inquiry |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
