Lixisenatide

Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM).

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Lixisenatide(CAS 320367-13-3)

CAT No: R1484

CAS No:320367-13-3

Synonyms/Alias:Lixisenatide;Adlyxin;Lyxumia;ZP10A peptide;ZP 10;320367-13-3;AVE0010;AQVE-10010;AVE 0010;lixisenatida;lixisenatidum;UNII-74O62BB01U;AVE 010;Lixisenatide [USAN:INN];AVE-010;ZP-10;DesPro36Exendin-4(1-39)-Lys6-NH2;Des-38-proline-exendine-4 (Heloderma suspectum)-(1-39)-peptidylpenta-L-lysyl-L-lysinamide;CHEBI:85662;74O62BB01U;DesPro38Exendin-4(1-39)-Lys6-NH2;H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2;H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2;H-L-His-Gly-L-Glu-Gly-L-Thr-L-Phe-L-Thr-L-Ser-L-Asp-L-Leu-L-Ser-L-Lys-L-Gln-L-Met-L-Glu-L-Glu-L-Glu-L-Ala-L-Val-L-Arg-L-Leu-L-Phe-L-Ile-L-Glu-L-Trp-L-Leu-L-Lys-L-Asn-Gly-Gly-L-Pro-L-Ser-L-Ser-Gly-L-Ala-L-Pro-L-Pro-L-Ser-L-Lys-L-Lys-L-Lys-L-Lys-L-Lys-L-Lys-NH2;Lixisenatide?;LIXISENATIDE (MART.);A10BJ03;FL76758;G13830;SOLIQUA 100/33 COMPONENT LIXISENATIDE;LIXISENATIDE COMPONENT OF SOLIQUA 100/33;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C215H347N61O65S
M.W/Mr.
4858
Sequence
One Letter Code:HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK
Three Letter Code:H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2

Lixisenatide is a synthetic peptide belonging to the class of glucagon-like peptide-1 (GLP-1) receptor agonists, designed to mimic the activity of endogenous incretin hormones. As a 44-amino acid peptide analog, it is structurally engineered for enhanced stability and receptor affinity, making it a valuable tool in metabolic and endocrinological research. Its ability to modulate key signaling pathways involved in glucose homeostasis has positioned it as a prominent molecule for investigating peptide hormone function, receptor pharmacology, and metabolic regulation. The well-characterized sequence and defined mechanism of action make lixisenatide a reliable standard in studies probing peptide-receptor interactions and downstream cellular effects.

Peptide hormone signaling research: Lixisenatide serves as a robust model for elucidating the mechanisms underlying GLP-1 receptor activation and downstream signaling cascades. By engaging with the GLP-1 receptor on pancreatic beta cells and other target tissues, it facilitates detailed study of intracellular pathways such as cyclic AMP production, protein kinase A activation, and calcium influx. Researchers leverage these properties to dissect the molecular events governing insulin secretion, cellular responsiveness to incretins, and broader aspects of hormone-receptor biology.

Metabolic pathway analysis: The peptide is extensively employed in experimental models to investigate the regulation of glucose metabolism and energy balance. By modulating insulinotropic and glucagonostatic effects, lixisenatide enables the exploration of metabolic flux, nutrient sensing, and the interplay between pancreatic and extra-pancreatic tissues. Its use in in vitro and in vivo systems supports the identification of novel metabolic regulators, assessment of peptide analog efficacy, and validation of metabolic biomarkers.

Peptide-receptor interaction studies: Lixisenatide's defined sequence and high receptor selectivity make it an ideal ligand for binding assays, structure-activity relationship (SAR) analyses, and receptor mutagenesis experiments. Researchers utilize the peptide to map receptor binding domains, characterize ligand-receptor conformational changes, and quantify affinity constants. Such studies provide critical insights into peptide engineering, receptor pharmacology, and the development of next-generation peptide therapeutics.

Pharmacokinetic and stability profiling: Due to its engineered resistance to enzymatic degradation, lixisenatide is commonly used as a reference compound in peptide stability assays and pharmacokinetic evaluations. These investigations aid in understanding peptide half-life, protease susceptibility, and bioavailability in various biological matrices. The data generated inform the rational design of peptide analogs with improved pharmacological properties for research applications.

Analytical method development: The unique physicochemical properties of lixisenatide facilitate its use as a standard or reference material in the development and validation of analytical techniques such as liquid chromatography-mass spectrometry (LC-MS) and immunoassays. Its defined sequence and stability profile support the calibration of detection methods, quantification of peptide concentrations, and assessment of assay specificity and sensitivity in complex biological samples. These applications are essential for ensuring reproducibility and accuracy in peptide quantitation workflows.

Shipping Condition
Room temperature in continental US; may vary elsewhere.
InChI
InChI=1S/C215H347N61O65S/c1-16-115(10)173(210(337)256-141(68-74-170(299)300)194(321)261-148(94-122-98-232-126-50-24-23-49-124(122)126)199(326)258-143(89-111(2)3)196(323)247-134(58-32-40-83-223)189(316)262-149(96-160(226)285)180(307)235-100-161(286)233-104-165(290)274-85-42-60-156(274)207(334)267-154(108-280)206(333)265-151(105-277)181(308)237-101-162(287)239-117(12)213(340)276-87-44-62-158(276)214(341)275-86-43-61-157(275)208(335)268-153(107-279)204(331)249-132(56-30-38-81-221)187(314)246-131(55-29-37-80-220)186(313)245-130(54-28-36-79-219)185(312)244-129(53-27-35-78-218)184(311)243-128(52-26-34-77-217)183(310)242-127(176(227)303)51-25-33-76-216)272-201(328)146(92-120-45-19-17-20-46-120)260-197(324)144(90-112(4)5)257-190(317)135(59-41-84-231-215(228)229)255-209(336)172(114(8)9)271-177(304)116(11)240-182(309)138(65-71-167(293)294)251-192(319)139(66-72-168(295)296)252-193(320)140(67-73-169(297)298)253-195(322)142(75-88-342-15)254-191(318)137(63-69-159(225)284)250-188(315)133(57-31-39-82-222)248-203(330)152(106-278)266-198(325)145(91-113(6)7)259-200(327)150(97-171(301)302)263-205(332)155(109-281)269-212(339)175(119(14)283)273-202(329)147(93-121-47-21-18-22-48-121)264-211(338)174(118(13)282)270-164(289)103-236-179(306)136(64-70-166(291)292)241-163(288)102-234-178(305)125(224)95-123-99-230-110-238-123/h17-24,45-50,98-99,110-119,125,127-158,172-175,232,277-283H,16,25-44,51-97,100-109,216-224H2,1-15H3,(H2,225,284)(H2,226,285)(H2,227,303)(H,230,238)(H,233,286)(H,234,305)(H,235,307)(H,236,306)(H,237,308)(H,239,287)(H,240,309)(H,241,288)(H,242,310)(H,243,311)(H,244,312)(H,245,313)(H,246,314)(H,247,323)(H,248,330)(H,249,331)(H,250,315)(H,251,319)(H,252,320)(H,253,322)(H,254,318)(H,255,336)(H,256,337)(H,257,317)(H,258,326)(H,259,327)(H,260,324)(H,261,321)(H,262,316)(H,263,332)(H,264,338)(H,265,333)(H,266,325)(H,267,334)(H,268,335)(H,269,339)(H,270,289)(H,271,304)(H,272,328)(H,273,329)(H,291,292)(H,293,294)(H,295,296)(H,297,298)(H,299,300)(H,301,302)(H4,228,229,231)/t115-,116-,117-,118+,119+,125-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,156-,157-,158-,172-,173-,174-,175-/m0/s1
InChI Key
XVVOERDUTLJJHN-IAEQDCLQSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisEpitope Mapping ServicesPeptide Analysis ServicesCustom Conjugation ServicePeptide Modification ServicescGMP Peptide ServicePeptide CDMOPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers