Lixisenatide

CAT#	R1484
CAS	320367-13-3
Synonyms/Alias	ZP-10(Des-Pro³⁸)-Exendin-4(-Lys)₆ amide
M.F/Formula	C₂₁₅H₃₄₇N₆₁O₆₅S
M.W/Mr.	4858.49
Sequence	One Letter Code: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 three Letter Code: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2

Storage	Desiccate at -20°C
Shipping Condition	Room temperature in continental US; may vary elsewhere.

CAT#	Product Name	M.W	Molecular Formula	Inquiry
R0845	Calcineurin Autoinhibitory Peptide			Inquiry
R1874	(R)-MG132			Inquiry
R1453	Insulin(cattle)			Inquiry
R1414	Hemorphin-7			Inquiry
HB00046	Fitc-YVAD-FMK			Inquiry

1. Application of human liver organoids as a patient-derived primary model for HBV infection and related hepatocellular carcinoma

2. Odorant binding protein based biomimetic sensors for detection of alcohols associated with Salmonella contamination in packaged beef

3. GLP-1, exendin-4 and C-peptide regulate pancreatic islet microcirculation, insulin secretion and glucose tolerance in rats

4. Zeta-potential-changing nanoparticles conjugated with cell-penetrating peptides for enhanced transfection efficiency

5. High fat diet and GLP-1 drugs induce pancreatic injury in mice