Lixisenatide

Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM).

Online Inquiry

CAT#R1484
CAS320367-13-3
Synonyms/AliasZP-10(Des-Pro³⁸)-Exendin-4(-Lys)₆ amide
M.F/FormulaC₂₁₅H₃₄₇N₆₁O₆₅S
M.W/Mr.4858.49
SequenceOne Letter Code: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2
three Letter Code: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2
Quick Inquiry
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

  BIM 189 is one of the most potent bombesin antagonists known in the guinea pig and 3T3 cell systems but has 40% ...

  Sinapultide (also known as KL4 peptide) is a synthetic protein used to mimic human SP-B. Respiratory distress ...

 Corticotropin-releasing factor (CRF) is a 41 amino acid peptide that is an important hormone in the hypothalamic ...

 GR 82334 is a spirolactam analog with the structure of [[(S, S) Pro-Leu (spiro-γ-lactam)]9,10, Trp11] Physalaemi ...

 Enfuvirtide, also named pentafuside, is an HIV fusion inhibitor originated at Duke University, where researchers ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Copyright © 2023 Creative Peptides. All rights reserved.