Lixisenatide

Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM).

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1484
CAS	320367-13-3
Synonyms/Alias	ZP-10(Des-Pro³⁸)-Exendin-4(-Lys)₆ amide
M.F/Formula	C₂₁₅H₃₄₇N₆₁O₆₅S
M.W/Mr.	4858.49
Sequence	One Letter Code: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 three Letter Code: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2

CAT#	Product Name	Inquiry
R1345	Enterostatin, human, mouse, rat	Inquiry
R1940	Tetradecanedioic acid	Inquiry
R1743	Urotensin II (114-124), human	Inquiry
R1472	Kv3, Channel Containing Protein 567-585	Inquiry
R2040	Cenegermin	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Storage	Desiccate at -20°C
Shipping Condition	Room temperature in continental US; may vary elsewhere.