Mambalgin 1

Mambalgin-1 is a blocker of ASIC1 channels. Through inhibiting acid-sensing ion channels (ASICs) expressed either in central or peripheral neurons, Mambalgin-1 is able to abolish pain, thus it acts as an analgesic.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Mambalgin 1(CAS 1609937-15-6)

CAT No: R0971

CAS No:1609937-15-6

Synonyms/Alias:Mambalgin 1;1609937-15-6;JPC93715;AKOS027470318;DA-65235;PD080274;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C272H429N85O84S9
M.W/Mr.
6522
Sequence
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK(Modifications: Disulfide bridge: 3-19, 12-37, 41-49, 50-55)
Labeling Target
Acid-sensing ion channels (ASICs)
Appearance
Lyophilized powder
Purity
>98%
Activity
Inhibitor

Mambalgin 1 is a peptide toxin originally isolated from the venom of the black mamba snake (Dendroaspis polylepis), recognized for its unique ability to modulate acid-sensing ion channels (ASICs) in neuronal tissues. As a member of the three-finger toxin family, Mambalgin 1 exhibits a distinct structural motif and high selectivity for ASIC subtypes, making it a valuable molecular tool in neurophysiological research. Its distinctive interaction with ion channels has positioned it as a reference compound for probing pain signaling pathways, ion channel pharmacology, and the broader field of peptide-neurotoxin interactions. Researchers utilize this peptide to dissect complex mechanisms of neuronal excitability and to explore the physiological roles of ASICs in both central and peripheral nervous systems.

Ion channel research: Mambalgin 1 is widely employed in the functional characterization of acid-sensing ion channels, particularly ASIC1a and ASIC1b. Its high affinity and subtype selectivity enable detailed investigation of ASIC gating, pharmacological modulation, and structure-activity relationships. By acting as a potent and reversible inhibitor, the peptide allows researchers to delineate the contributions of specific ASIC subunits to neuronal signaling, sensory transduction, and synaptic plasticity. Such studies are essential for understanding the molecular basis of neuronal excitability and the pathophysiology of pain perception.

Pain pathway elucidation: The peptide's capacity to inhibit ASIC-mediated currents has made it a key reagent in studies aimed at unraveling the molecular mechanisms underlying nociception. In both in vitro and ex vivo models, Mambalgin 1 is used to probe the role of ASICs in sensory neuron activation, inflammatory pain, and mechanotransduction. Its selective blockade of these ion channels helps distinguish ASIC-dependent signaling from other pain-related pathways, providing critical insights into the cellular processes that mediate pain sensation and hypersensitivity.

Peptide structure-function analysis: As a well-characterized member of the three-finger toxin superfamily, Mambalgin 1 serves as an important template for structure-function studies of bioactive peptides. Researchers employ it in mutagenesis experiments, computational modeling, and biophysical assays to map key residues responsible for target recognition and channel inhibition. These studies inform the rational design of novel peptide analogs with improved selectivity or altered pharmacological profiles, advancing the field of peptide engineering and venom-derived drug discovery.

Electrophysiological assay development: The peptide's robust and specific inhibitory activity on ASICs makes it a standard reference compound in electrophysiological recording protocols. Laboratories use Mambalgin 1 to validate assay performance, calibrate ion channel responses, and benchmark the effects of new ASIC modulators. Its application in patch-clamp, two-electrode voltage clamp, and automated electrophysiology platforms facilitates high-fidelity analysis of ion channel function, supporting both academic and industrial research initiatives.

Neuropharmacology tool compound: Due to its specificity and well-documented mechanism, Mambalgin 1 is frequently incorporated into neuropharmacological studies exploring the roles of ASICs in synaptic transmission, neuronal injury, and central nervous system disorders. Its use enables selective dissection of ASIC contributions within complex neural circuits, aiding in the identification of novel modulatory pathways and potential molecular targets for future research. The peptide's unique properties continue to drive innovation in the study of ion channel physiology and venom-derived neuroactive compounds.

Source#
Synthetic
InChI
InChI=1S/C272H429N85O84S9/c1-21-134(14)211-264(435)336-165(90-130(6)7)232(403)315-157(66-70-195(280)369)217(388)299-110-204(378)307-188(254(425)340-183(114-360)249(420)338-182(113-359)248(419)339-184(115-361)250(421)347-190-121-447-449-123-192(346-224(395)153(52-32-38-80-277)311-239(410)174(99-197(282)371)331-242(413)177(102-200(285)374)330-227(398)159(68-72-205(379)380)319-265(436)213(136(16)364)354-230(401)160(69-73-206(381)382)317-247(418)181(112-358)341-257(190)428)259(430)348-191-122-448-446-120-189(255(426)333-175(100-198(283)372)240(411)320-163(269(440)441)53-33-39-81-278)345-225(396)156(56-42-84-298-272(291)292)314-244(415)180(105-208(385)386)337-266(437)214(137(17)365)355-251(422)185(116-362)342-258(191)429)119-445-450-124-193-256(427)328-172(97-144-107-294-126-303-144)237(408)313-155(55-41-83-297-271(289)290)222(393)334-179(104-207(383)384)243(414)318-161(74-86-442-19)228(399)309-151(50-30-36-78-275)220(391)323-167(92-139-44-24-22-25-45-139)236(407)344-187(118-444-117-186(343-223(394)150(49-29-35-77-274)308-216(387)148(279)88-128(2)3)252(423)324-168(94-141-58-62-146(367)63-59-141)233(404)316-158(67-71-196(281)370)226(397)326-171(96-143-106-293-125-302-143)218(389)300-109-202(376)305-149(48-28-34-76-273)229(400)350-209(132(10)11)262(433)351-210(133(12)13)263(434)356-215(138(18)366)267(438)349-193)253(424)325-169(95-142-60-64-147(368)65-61-142)235(406)327-173(98-145-108-295-127-304-145)238(409)332-178(103-201(286)375)246(417)353-212(135(15)363)261(432)301-111-203(377)306-162(75-87-443-20)268(439)357-85-43-57-194(357)260(431)335-170(93-140-46-26-23-27-47-140)234(405)312-154(54-40-82-296-270(287)288)221(392)329-176(101-199(284)373)241(412)322-164(89-129(4)5)231(402)310-152(51-31-37-79-276)219(390)321-166(91-131(8)9)245(416)352-211/h22-27,44-47,58-65,106-108,125-138,148-194,209-215,358-368H,21,28-43,48-57,66-105,109-124,273-279H2,1-20H3,(H2,280,369)(H2,281,370)(H2,282,371)(H2,283,372)(H2,284,373)(H2,285,374)(H2,286,375)(H,293,302)(H,294,303)(H,295,304)(H,299,388)(H,300,389)(H,301,432)(H,305,376)(H,306,377)(H,307,378)(H,308,387)(H,309,399)(H,310,402)(H,311,410)(H,312,405)(H,313,408)(H,314,415)(H,315,403)(H,316,404)(H,317,418)(H,318,414)(H,319,436)(H,320,411)(H,321,390)(H,322,412)(H,323,391)(H,324,423)(H,325,424)(H,326,397)(H,327,406)(H,328,427)(H,329,392)(H,330,398)(H,331,413)(H,332,409)(H,333,426)(H,334,393)(H,335,431)(H,336,435)(H,337,437)(H,338,420)(H,339,419)(H,340,425)(H,341,428)(H,342,429)(H,343,394)(H,344,407)(H,345,396)(H,346,395)(H,347,421)(H,348,430)(H,349,438)(H,350,400)(H,351,433)(H,352,416)(H,353,417)(H,354,401)(H,355,422)(H,356,434)(H,379,380)(H,381,382)(H,383,384)(H,385,386)(H,440,441)(H4,287,288,296)(H4,289,290,297)(H4,291,292,298)
InChI Key
JRVGGBDTNREHFW-UHFFFAOYSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServicePeptide Analysis ServicesPeptide Nucleic Acids SynthesisEpitope Mapping ServicesPeptide Synthesis ServicesPeptide Modification ServicesCustom Conjugation ServicePeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers