Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GFGCPNDYSCSNHCRDSIGCRGGYCKYQLICTCYGCKKRRSIQE |
Activity | Gram+ & Gram-, |
Host Chemicals | adductor, foot, gill, hemocyte, mantle, palp, and siphon; Manila clams, Ruditapes philippinarum |
Length | 44 |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.