Keywords Search Google Search Search

Mussel defensin MGD-2

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2769
Sequence	GFGCPNNYACHQHCKSIRGYCGGYCAGWFRLRCTCYRCG
Activity	Antibacterial, Antifungal

CAT#	Product Name	Inquiry
AF008	Cyclopeptide E	Inquiry
AF184	FK-13	Inquiry
AF2764	Cecropin-D-like peptide	Inquiry
AF3308	cgMolluscidin	Inquiry
AF3001	Moricin-like peptide B	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of GsMTx4 in advanced atrial fibrillation

GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...

Function of ecallantide in hereditary angioedema

Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...

Medical value of catestatin

Catestain, a 21 amino acid fragment of chromogranin A (CgA), is divided into human CgA352-372 and bovine CgA344- ...

The mechanism and effect of hexapeptide-9

The hexapeptide-9, a cosmetic peptide of skin agingSkin aging is the obvious external manifestation of a natural ...

The function of Margatoxin in blocking K+ channels

Margatoxin (MgTX) is a 39 amino acid peptide with significant sequence homology to charybdotoxin (ChTX), and ha ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Mytilus galloprovincialis
Length	39