Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C424H683N117O137 |
M.W/Mr. | 9611.79 |
Sequence | VPIDVDKTKVHNTEPVENARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGR |
Length | 63 |
2. TMEM16F and dynamins control expansive plasma membrane reservoirs
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.