Nesiritide Acetate

Nesiritide Acetate is a brain natriuretic peptide secreted by the human heart in response to cardiac volume or pressure.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Nesiritide Acetate(CAS 114471-18-0)

CAT No: 10-101-262

CAS No:114471-18-0

Synonyms/Alias:Nesiritide Acetate;114471-18-0;natriureticpeptide; BNP-32;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C145H248N50O44S4
M.W/Mr.
3524.1
Sequence
One Letter Code:SPKMVQGSGCFGRCGLGSSSSIRDMKKVLRRH
Three Letter Code:H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys(1)-Phe-Gly-Arg-Cys(1)-Gly-Leu-Gly-Ser-Ser-Ser-Ser-Ile-Arg-Asp-Met-Lys-Lys-Val-Leu-Arg-Arg-His-OH.CH3CO2H
Appearance
White to off white powder
Purity
≥98% (HPLC)
Activity
Agonist
Biological Activity
Nesiritide acetate is an agonist of natriuretic peptide receptors (NPRs), with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively.

Nesiritide Acetate is a synthetic peptide that mirrors the structure and biological activity of human B-type natriuretic peptide (BNP). As a member of the natriuretic peptide family, it exhibits a complex mechanism of action that involves binding to natriuretic peptide receptors, leading to increased cyclic guanosine monophosphate (cGMP) production. This cascade produces a range of physiological effects, including vasodilation, natriuresis, and diuresis, making Nesiritide Acetate a valuable tool in cardiovascular and renal research. The peptide's stability and bioactivity allow for reliable experimental outcomes, and its compatibility with various in vitro and in vivo models supports broad scientific exploration. Researchers value its well-characterized pharmacological profile and ability to mimic endogenous BNP, which facilitates the study of natriuretic peptide pathways and related signaling networks.

Cardiovascular Physiology Research: Nesiritide Acetate is extensively utilized in cardiovascular physiology studies to investigate the mechanisms underlying heart function and vascular tone regulation. By activating natriuretic peptide receptor-A and increasing cGMP levels, it enables researchers to model the physiological responses associated with endogenous BNP release. This application is critical for dissecting the pathways responsible for vasodilation, blood pressure modulation, and cardiac remodeling. The peptide's predictable activity profile allows for controlled experiments that elucidate the roles of natriuretic peptides in both healthy and diseased cardiac tissues.

Renal Function Studies: In nephrology research, Nesiritide Acetate serves as a potent experimental agent for examining renal hemodynamics and sodium excretion. Its natriuretic and diuretic properties make it ideal for probing kidney function, glomerular filtration rate, and tubular sodium handling. By administering the peptide in animal models or ex vivo systems, investigators can assess the direct and indirect effects of natriuretic peptides on renal physiology, providing critical insights into fluid balance and electrolyte regulation.

Signal Transduction Analysis: The study of cellular signaling pathways benefits from the use of Nesiritide Acetate as a selective activator of natriuretic peptide receptors. Researchers employ it to evaluate downstream cGMP-mediated events, including protein kinase G activation and subsequent target phosphorylation. Such studies help clarify the molecular mechanisms by which natriuretic peptides exert their biological effects, offering a platform for understanding receptor-ligand interactions, second messenger dynamics, and cross-talk with other signaling cascades.

Pharmacological Screening: As a reference compound, Nesiritide Acetate is frequently incorporated into pharmacological screening assays aimed at identifying novel modulators of the natriuretic peptide system. Its well-defined activity enables benchmarking of new drug candidates, peptides, or small molecules that target BNP pathways. This application supports drug discovery efforts by providing a standard for efficacy and mechanism-based comparisons, accelerating the identification of promising therapeutic leads for cardiovascular and renal conditions.

Biomarker Validation and Analytical Method Development: The peptide also plays a role in the validation of BNP-related biomarkers and the optimization of analytical techniques. By serving as a calibration or control standard in immunoassays, mass spectrometry, or bioanalytical platforms, Nesiritide Acetate facilitates the accurate quantification of BNP and related peptides in biological samples. This capability is essential for developing robust diagnostic tools and for advancing translational research investigating the role of natriuretic peptides in human health and disease.

Vascular Biology and Endothelial Function Studies: Researchers investigating vascular biology utilize Nesiritide Acetate to explore the peptide's influence on endothelial cell function, vascular permeability, and inflammatory responses. Its ability to induce vasorelaxation and modulate endothelial signaling pathways makes it a valuable agent for dissecting the molecular basis of vascular homeostasis. These studies contribute to a deeper understanding of how natriuretic peptides protect against endothelial dysfunction, support vascular repair, and maintain circulatory system integrity under physiological and pathological conditions.

Source#
Synthetic
Long-term Storage Conditions
Soluble in water, acid.
Shipping Condition
Shipped at room temperature
InChI
InChI=1S/C143H244N50O42S4.C2H4O2/c1-13-76(10)112(137(232)180-86(36-26-48-161-143(155)156)122(217)183-93(56-109(206)207)128(223)178-88(40-50-236-11)124(219)173-81(30-17-20-42-144)119(214)174-83(32-19-22-44-146)125(220)190-111(75(8)9)136(231)184-91(53-73(4)5)127(222)176-84(34-24-46-159-141(151)152)121(216)175-85(35-25-47-160-142(153)154)123(218)185-94(139(234)235)55-78-57-157-71-167-78)192-132(227)99(68-199)188-131(226)98(67-198)187-130(225)97(66-197)186-129(224)96(65-196)171-107(204)61-163-114(209)90(52-72(2)3)169-105(202)59-166-117(212)100-69-238-239-70-101(133(228)182-92(54-77-28-15-14-16-29-77)115(210)164-58-104(201)168-80(118(213)189-100)33-23-45-158-140(149)150)172-108(205)62-165-116(211)95(64-195)170-106(203)60-162-113(208)87(38-39-103(148)200)181-135(230)110(74(6)7)191-126(221)89(41-51-237-12)177-120(215)82(31-18-21-43-145)179-134(229)102-37-27-49-193(102)138(233)79(147)63-194;1-2(3)4/h14-16,28-29,57,71-76,79-102,110-112,194-199H,13,17-27,30-56,58-70,144-147H2,1-12H3,(H2,148,200)(H,157,167)(H,162,208)(H,163,209)(H,164,210)(H,165,211)(H,166,212)(H,168,201)(H,169,202)(H,170,203)(H,171,204)(H,172,205)(H,173,219)(H,174,214)(H,175,216)(H,176,222)(H,177,215)(H,178,223)(H,179,229)(H,180,232)(H,181,230)(H,182,228)(H,183,217)(H,184,231)(H,185,218)(H,186,224)(H,187,225)(H,188,226)(H,189,213)(H,190,220)(H,191,221)(H,192,227)(H,206,207)(H,234,235)(H4,149,150,158)(H4,151,152,159)(H4,153,154,160)(H4,155,156,161);1H3,(H,3,4)/t76-,79-,80-,81-,82-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,110-,111-,112-;/m0./s1
InChI Key
FJULFJFRGUHITK-INJFIXSDSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisEpitope Mapping ServicesPeptide Modification ServicesCustom Conjugation ServicePeptide Analysis ServicesPeptide Synthesis ServicesPeptide CDMOcGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers