- Home
- COVID-19
- Services
- Products
- Research Areas
- Company
- Resources
- Ordering
Tetracosactide is a synthetic peptide, which corresponds to the first 24 amino acids of the naturally occurring hormone ACTH (adrenocorticotropic hormone). It stimulates the adrenal cortex to produce corticosteroids, mineralocorticoids, and, to a lesser extent, androgens.
| CAT# | 10-101-262 |
| Explanation | Nesiritide Acetate is a brain natriuretic peptide secreted by the human heart in response to cardiac volume or pressure. |
| Synonyms/Alias | Brain Natriuretic Peptide-32; BNP-32 |
| M.F/Formula | C143H244N50O42S4 |
| M.W/Mr. | 3464.1 |
| Sequence | One Letter Code: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH Three Letter Code: H-Ser-Pro-Lys-Met-Val-Gin-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-lle-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (Disulfide Bridge Cys10-Cys26) |
| Appearance | White to off white powder |
| Purity | ≥98% (HPLC) |
| Activity | Agonist |
| Biological Activity | Nesiritide acetate is an agonist of natriuretic peptide receptors (NPRs), with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively. |
| Source# | Synthetic | Long-term Storage Conditions | Soluble in water, acid. | Shipping Condition | Shipped at room temperature |
| CAT# | Product Name | M.W | Molecular Formula | Inquiry |
|---|---|---|---|---|
| 10-101-297 | γ-Glu-Glu | Inquiry | ||
| 10-101-01 | Tetracosactide Acetate | Inquiry | ||
| 10-101-159 | Dulaglutide | Inquiry | ||
| 10-101-280 | β-Casomorphin (1-7), bovine | Inquiry | ||
| HB00089 | Gly-Gly-Tyr-Arg | Inquiry |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
