Nesiritide Acetate

Nesiritide Acetate is a brain natriuretic peptide secreted by the human heart in response to cardiac volume or pressure.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Nesiritide Acetate(CAS 114471-18-0)

CAT No: 10-101-262

CAS No:114471-18-0

Synonyms/Alias:Nesiritide Acetate;114471-18-0;natriureticpeptide; BNP-32;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C145H248N50O44S4
M.W/Mr.
3524.1
Sequence
One Letter Code:SPKMVQGSGCFGRCGLGSSSSIRDMKKVLRRH
Three Letter Code:H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys(1)-Phe-Gly-Arg-Cys(1)-Gly-Leu-Gly-Ser-Ser-Ser-Ser-Ile-Arg-Asp-Met-Lys-Lys-Val-Leu-Arg-Arg-His-OH.CH3CO2H
Appearance
White to off white powder
Purity
≥98% (HPLC)
Activity
Agonist
Biological Activity
Nesiritide acetate is an agonist of natriuretic peptide receptors (NPRs), with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively.

Nesiritide Acetate is a synthetic peptide corresponding to the recombinant form of human B-type natriuretic peptide (BNP). As a member of the natriuretic peptide family, it is characterized by its 32-amino acid structure and distinctive disulfide ring, which are essential for its biological activity. Nesiritide Acetate is widely recognized for its role in modulating cardiovascular homeostasis, particularly through its effects on natriuresis, vasodilation, and inhibition of the renin-angiotensin-aldosterone system. In biochemical and physiological research, it serves as a valuable tool for elucidating the signaling pathways and receptor interactions associated with endogenous natriuretic peptides, supporting a deeper understanding of fluid balance, vascular function, and peptide-receptor pharmacology.

Peptide signaling pathway research: Nesiritide provides a robust model for investigating the molecular mechanisms underlying natriuretic peptide receptor activation, particularly the guanylyl cyclase-A (GC-A) pathway. By enabling controlled activation of this receptor, researchers can delineate downstream effects such as cyclic GMP production, protein kinase G activation, and subsequent physiological responses. This peptide is instrumental in mapping the cascade of intracellular events triggered by BNP-like molecules, offering insights into receptor specificity, desensitization, and cross-talk with other signaling networks.

Cardiovascular physiology studies: The compound is frequently utilized in experimental settings to model the effects of natriuretic peptides on vascular tone, cardiac function, and renal sodium handling. Through in vitro and ex vivo assays, Nesiritide enables precise assessment of vasodilatory responses, endothelial function, and the regulation of hemodynamics. Its application extends to studies on myocardial contractility, ventricular remodeling, and the interplay between cardiac peptides and neurohormonal systems, providing a foundation for understanding cardiovascular adaptation and stress responses.

Peptide-receptor interaction assays: Nesiritide is a preferred ligand in binding studies aimed at characterizing the affinity, selectivity, and kinetics of natriuretic peptide receptors. By employing radiolabeled or fluorescently tagged forms, researchers can quantify receptor occupancy, determine binding constants, and investigate receptor distribution across tissues. These assays facilitate the identification of novel receptor subtypes, allosteric modulators, and the structural determinants of peptide-receptor engagement, advancing the field of peptide pharmacology.

Analytical method development: The peptide serves as a reference standard in the development and validation of analytical techniques for natriuretic peptide quantification. It is commonly used to calibrate immunoassays, mass spectrometry protocols, and chromatographic methods designed to measure endogenous or exogenous BNP-like molecules in biological samples. Nesiritide's well-defined structure and stability make it an ideal benchmark for ensuring assay accuracy, sensitivity, and reproducibility in both basic and translational research contexts.

Peptide synthesis and modification studies: Nesiritide Acetate is also employed as a model substrate for examining peptide synthesis methodologies, post-synthetic modifications, and structure-activity relationships. Its relatively complex folding and disulfide bond formation present practical challenges for synthetic chemists, driving innovations in peptide assembly, purification, and characterization. These studies contribute to the optimization of synthetic strategies for other bioactive peptides and support the exploration of analogs with altered pharmacological profiles.

Source#
Synthetic
Long-term Storage Conditions
Soluble in water, acid.
Shipping Condition
Shipped at room temperature
InChI
InChI=1S/C143H244N50O42S4.C2H4O2/c1-13-76(10)112(137(232)180-86(36-26-48-161-143(155)156)122(217)183-93(56-109(206)207)128(223)178-88(40-50-236-11)124(219)173-81(30-17-20-42-144)119(214)174-83(32-19-22-44-146)125(220)190-111(75(8)9)136(231)184-91(53-73(4)5)127(222)176-84(34-24-46-159-141(151)152)121(216)175-85(35-25-47-160-142(153)154)123(218)185-94(139(234)235)55-78-57-157-71-167-78)192-132(227)99(68-199)188-131(226)98(67-198)187-130(225)97(66-197)186-129(224)96(65-196)171-107(204)61-163-114(209)90(52-72(2)3)169-105(202)59-166-117(212)100-69-238-239-70-101(133(228)182-92(54-77-28-15-14-16-29-77)115(210)164-58-104(201)168-80(118(213)189-100)33-23-45-158-140(149)150)172-108(205)62-165-116(211)95(64-195)170-106(203)60-162-113(208)87(38-39-103(148)200)181-135(230)110(74(6)7)191-126(221)89(41-51-237-12)177-120(215)82(31-18-21-43-145)179-134(229)102-37-27-49-193(102)138(233)79(147)63-194;1-2(3)4/h14-16,28-29,57,71-76,79-102,110-112,194-199H,13,17-27,30-56,58-70,144-147H2,1-12H3,(H2,148,200)(H,157,167)(H,162,208)(H,163,209)(H,164,210)(H,165,211)(H,166,212)(H,168,201)(H,169,202)(H,170,203)(H,171,204)(H,172,205)(H,173,219)(H,174,214)(H,175,216)(H,176,222)(H,177,215)(H,178,223)(H,179,229)(H,180,232)(H,181,230)(H,182,228)(H,183,217)(H,184,231)(H,185,218)(H,186,224)(H,187,225)(H,188,226)(H,189,213)(H,190,220)(H,191,221)(H,192,227)(H,206,207)(H,234,235)(H4,149,150,158)(H4,151,152,159)(H4,153,154,160)(H4,155,156,161);1H3,(H,3,4)/t76-,79-,80-,81-,82-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,110-,111-,112-;/m0./s1
InChI Key
FJULFJFRGUHITK-INJFIXSDSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisPeptide Analysis ServicescGMP Peptide ServicePeptide Modification ServicesPeptide CDMOCustom Conjugation ServicePeptide Synthesis ServicesEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers