1. Home
  2. Products
  3. Therapeutic Peptides
  4. APIs
  5. Nesiritide Acetate

Nesiritide Acetate

Nesiritide Acetate is a brain natriuretic peptide secreted by the human heart in response to cardiac volume or pressure.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Nesiritide Acetate(CAS 114471-18-0)

CAT No: 10-101-262

CAS No:114471-18-0

Synonyms/Alias:Nesiritide Acetate;114471-18-0;natriureticpeptide; BNP-32;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C145H248N50O44S4
M.W/Mr.
3524.1
Sequence
One Letter Code:SPKMVQGSGCFGRCGLGSSSSIRDMKKVLRRH
Three Letter Code:H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys(1)-Phe-Gly-Arg-Cys(1)-Gly-Leu-Gly-Ser-Ser-Ser-Ser-Ile-Arg-Asp-Met-Lys-Lys-Val-Leu-Arg-Arg-His-OH.CH3CO2H
Appearance
White to off white powder
Purity
≥98% (HPLC)
Activity
Agonist
Biological Activity
Nesiritide acetate is an agonist of natriuretic peptide receptors (NPRs), with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively.
Source#
Synthetic
Long-term Storage Conditions
Soluble in water, acid.
Shipping Condition
Shipped at room temperature
InChI
InChI=1S/C143H244N50O42S4.C2H4O2/c1-13-76(10)112(137(232)180-86(36-26-48-161-143(155)156)122(217)183-93(56-109(206)207)128(223)178-88(40-50-236-11)124(219)173-81(30-17-20-42-144)119(214)174-83(32-19-22-44-146)125(220)190-111(75(8)9)136(231)184-91(53-73(4)5)127(222)176-84(34-24-46-159-141(151)152)121(216)175-85(35-25-47-160-142(153)154)123(218)185-94(139(234)235)55-78-57-157-71-167-78)192-132(227)99(68-199)188-131(226)98(67-198)187-130(225)97(66-197)186-129(224)96(65-196)171-107(204)61-163-114(209)90(52-72(2)3)169-105(202)59-166-117(212)100-69-238-239-70-101(133(228)182-92(54-77-28-15-14-16-29-77)115(210)164-58-104(201)168-80(118(213)189-100)33-23-45-158-140(149)150)172-108(205)62-165-116(211)95(64-195)170-106(203)60-162-113(208)87(38-39-103(148)200)181-135(230)110(74(6)7)191-126(221)89(41-51-237-12)177-120(215)82(31-18-21-43-145)179-134(229)102-37-27-49-193(102)138(233)79(147)63-194;1-2(3)4/h14-16,28-29,57,71-76,79-102,110-112,194-199H,13,17-27,30-56,58-70,144-147H2,1-12H3,(H2,148,200)(H,157,167)(H,162,208)(H,163,209)(H,164,210)(H,165,211)(H,166,212)(H,168,201)(H,169,202)(H,170,203)(H,171,204)(H,172,205)(H,173,219)(H,174,214)(H,175,216)(H,176,222)(H,177,215)(H,178,223)(H,179,229)(H,180,232)(H,181,230)(H,182,228)(H,183,217)(H,184,231)(H,185,218)(H,186,224)(H,187,225)(H,188,226)(H,189,213)(H,190,220)(H,191,221)(H,192,227)(H,206,207)(H,234,235)(H4,149,150,158)(H4,151,152,159)(H4,153,154,160)(H4,155,156,161);1H3,(H,3,4)/t76-,79-,80-,81-,82-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,110-,111-,112-;/m0./s1
InChI Key
FJULFJFRGUHITK-INJFIXSDSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicesPeptide Nucleic Acids SynthesisPeptide CDMOcGMP Peptide ServicePeptide Synthesis ServicesPeptide Modification ServicesCustom Conjugation ServicePeptide Analysis Services
Hot Products
Somatostatin

Somatostatin peptide inhibits the secretion of growth hormone and insulin. Purchase high-purity Somatostatin for metabolic, neuroendocrine, and cancer research.

Read More Read More
DOTA-cyclo(RGDfK) acetate

DOTA-cyclo(RGDfK) acetate is a metal-chelating cyclic RGD peptide used to investigate integrin-binding motifs. Its cyclized structure stabilizes ligand presentation for receptor-targeting studies. Researchers analyze its conformation for high-affinity binding models. The DOTA moiety supports imaging-related biochemical experiments.

Read More Read More
Carperitide

Carperitide is a human atrial natriuretic peptide analog for heart and kidney research. Buy Carperitide peptide online to study diuretic and cardiovascular effects.

Read More Read More
Deslorelin

Deslorelin peptide is a potent GnRH agonist used for fertility and hormonal control. Buy Deslorelin peptide powder online for veterinary and endocrine research applications.

Read More Read More
GLP-1 (7-37) Acetate

GLP-1 (7-37) Acetate is a synthetic peptide for appetite and insulin regulation. Order GLP-1 peptide powder from a trusted supplier for metabolic research.

Read More Read More
Lanreotide Acetate

Lanreotide Acetate is a somatostatin analog peptide regulating hormone secretion. Purchase Lanreotide peptide online to study tumor suppression and endocrine disorders.

Read More Read More
Carbetocin

Carbetocin is a synthetic oxytocin analog that promotes uterine contraction and postpartum recovery. Buy Carbetocin peptide powder from a professional supplier for reproductive research.

Read More Read More
Gonadorelin Acetate

Gonadorelin Acetate stimulates LH and FSH release in fertility research. Purchase Gonadorelin peptide powder from a verified peptide supplier for reproductive studies.

Read More Read More
Teduglutide

Teduglutide peptide enhances intestinal absorption and mucosal growth. Buy Teduglutide research peptide to support gastrointestinal and metabolic studies.

Read More Read More
Antide

Antide is a GnRH antagonist peptide used in reproductive hormone research. Buy Antide peptide powder from a reliable peptide supplier for endocrine studies.

Read More Read More
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers