Nesiritide Acetate

Tetracosactide is a synthetic peptide, which corresponds to the first 24 amino acids of the naturally occurring hormone ACTH (adrenocorticotropic hormone). It stimulates the adrenal cortex to produce corticosteroids, mineralocorticoids, and, to a lesser extent, androgens.

Online Inquiry

CAT#10-101-262
ExplanationNesiritide Acetate is a brain natriuretic peptide secreted by the human heart in response to cardiac volume or pressure.
Synonyms/AliasBrain Natriuretic Peptide-32; BNP-32
M.F/FormulaC143H244N50O42S4
M.W/Mr.3464.1
SequenceOne Letter Code: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Three Letter Code: H-Ser-Pro-Lys-Met-Val-Gin-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-lle-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (Disulfide Bridge Cys10-Cys26)
AppearanceWhite to off white powder
Purity≥98% (HPLC)
ActivityAgonist
Biological ActivityNesiritide acetate is an agonist of natriuretic peptide receptors (NPRs), with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively.
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Contact Us

Address:

Tel: |

Email:

Copyright © 2022 Creative Peptides. All rights reserved.