Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
M.F/Formula | C182H282N54O52S4 |
M.W/Mr. | 4186.84 |
Sequence | EIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV |
Length | 35 |
1. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
5. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
Required fields are marked with *
×Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.