CAT# | N05013 |
M.F/Formula | C180H276N54O55S1 |
M.W/Mr. | 4108.6 |
Sequence | PSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 |
Length | 35 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
N05016 | (Gly1,Ser3.22,Gln4.34,Thr6,Arg19,Tyr21,Ala23.31,Aib32)-P | Inquiry | ||
N05011 | Neuropeptide Y (3-36), human | Inquiry | ||
N05035 | (D-Tyr27·36,D-Thr32)-Neuropeptide Y (27-36) | Inquiry | ||
N05031 | (Ala31,Aib32)-Neuropeptide Y (porcine) | Inquiry | ||
N05019 | [Leu31,Pro34] Neuropeptide Y (1-36), porcine | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Acetyl Glutamyl Heptapeptide-3, named SNAP-8, Acetyl GlutaMyl Octapeptide-3, Acetyl Octapeptide-1, Acetyl Octape ...
Glucagon is a 29-amino acid peptide hormone that is synthesized in pancreatic α cells from the proglucagon precursor by proho ...
Orexin A (OXA) and orexin B (OXB) are hypothalamic neuropeptides discovered in 1998, which bind to two G-protein ...
Pep2m, a peptide inhibitor of GluA2 subunit binding to NSF, reduces α-amino- 3-hydroxy-5-methyl-isoxazolepropion ...
Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...