CAT# | N05013 |
M.F/Formula | C180H276N54O55S1 |
M.W/Mr. | 4108.6 |
Sequence | PSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 |
Length | 35 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
N05016 | (Gly1,Ser3.22,Gln4.34,Thr6,Arg19,Tyr21,Ala23.31,Aib32)-P | Inquiry | ||
N05024 | Neuropeptide Y, sheep | Inquiry | ||
N05037 | Biotinyl-Neuropeptide Y (human, rat) | Inquiry | ||
N05027 | Neuropeptide Y, free acid, human, rat | Inquiry | ||
N05036 | (Tyr(Me)21)-Neuropeptide Y (human, rat) | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...
Dipeptide diaminobutyroyl benzylamide diacetate, often marketed under the name Syn-Ake, is a synthetic peptide that mimics th ...
Obestatin is a 23-amino acid peptide hormone produced in specific epithelial cells of the stomach and small inte ...
APC 366 [N-(1-hydroxy-2-naphthoyl)-L-arginyl-L-prolinamide], is a novel selective inhibitor of mast cell tryptas ...
Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...