Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | RRCICTTRTCRFPYRRLGTCLFQNRVYTFCC |
Activity | Antibacterial, Antifungal, Antiviral |
Host Chemicals | Cavia porcellus |
Length | 31 |
SwissProt ID | P49112 |
1. Myotropic activity of allatostatins in tenebrionid beetles
3. The spatiotemporal control of signalling and trafficking of the GLP-1R
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.