Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | ACYCRIPACLAGERRYGTCFYRRRVWAFCC |
Activity | Antibacterial, Antifungal |
Host Chemicals | Macaca mulatta |
Length | 30 |
SwissProt ID | P60031 |
1. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
5. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.