CAT# | AF1865 |
Sequence | ACYCRIPACLAGERRYGTCFYRRRVWAFCC |
Activity | Antibacterial, Antifungal |
Host Chemicals | Macaca mulatta | Length | 30 | SwissProt ID | P60031 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF3110 | BHT-B | Inquiry | ||
AF1551 | Lantibiotic nukacin | Inquiry | ||
AF430 | Dybowskin-4 | Inquiry | ||
AF032 | Anticancerous peptide 1 | Inquiry | ||
AF2416 | Antibiotic peptide cecropin B2 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Endothelin-1 (ET-1) is a vasoactive peptide containing 21 amino acids, which was first isolated from the culture ...
As a small actin-binding protein upregulated in highly metastatic prostate cancer cells, thymosin β15 (Tβ15) has ...
Catestain, a 21 amino acid fragment of chromogranin A (CgA), is divided into human CgA352-372 and bovine CgA344- ...
UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...
Angiotensin Ⅱ is a kind of peptides generally produced by the hydrolysis of the angiotensin Ⅰ under the angioten ...