Keywords Search Google Search Search

Neutrophil defensin 3

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF1865
Sequence	ACYCRIPACLAGERRYGTCFYRRRVWAFCC
Activity	Antibacterial, Antifungal

CAT#	Product Name	Inquiry
AF245	UyCT2	Inquiry
AF127	Myxinidin	Inquiry
AF1768	Palustrin-2AJ1	Inquiry
AF2171	Callinectin	Inquiry
AF2324	Neutrophil antibiotic peptide NP-4	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Function of Dipeptide-4 in Human Skin

An of Dipeptide A Peptide is a constituent fragment in the structure of a protein and is linked by an amide bond ...

A highly selective intravenous anesthetic agent- Etomidate

Etomidate, a highly selective intravenous anesthetic agent, was first synthesized at Janssen Pharmaceuticals in ...

A Cellular Gβγ Antagonist, GRK2i

GRK2i, a GRK2 inhibitory polypeptide, specifically inhibits Gβγ activation of GRK2. It corresponds to the Gβγ-bi ...

Function of pramlintide in diabetes

Pramlintide is a synthetic analogue of pancreatic amyloid polypeptide. Pancreatic amyloid polypeptide is a polyp ...

Function of Psalmotoxin 1 in against pain

Acid-sensitive ion channels (ASICs) are a class of proton-gated ion channels belonging to the Degenerin/Epitheli ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Macaca mulatta
Length	30
SwissProt ID	P60031