Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4257 |
Sequence | SLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRF-NH2 |
Length | 37 |
3. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
4. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
5. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.