Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GLLSGILGAGKHIVCGLSGPCQSLNRKSSDVEYHLAKC |
Activity | Antibacterial, Antifungal |
Host Chemicals | Odorrana grahami |
Length | 38 |
SwissProt ID | A6MBR1 |
1. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
2. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
5. Implications of ligand-receptor binding kinetics on GLP-1R signalling
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.