Home > Product > Antimicrobial Peptides > Oh-defensin

Antimicrobial Peptides

Oh-defensin

Price Inquiry
CAT#
AF3295
Sequence
MLCKLSMFGAVLGVPACAIDCLPMGKTGGSCEGGVCGCRKLTFKILWDKKFG
Host Chemicals
Venoms, Ornithoctonus hainana
Length
52
Activity
Gram+ & Gram-, Fungi,

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.