Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | ERSCITWRNSCMHNDKGCCFPWSCVCWSQTVSRNSSRKEKKCQCRLW |
Length | 47 |
Modifications | Disulfide bond(4) |
3. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
5. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.