Keywords Search Google Search Search

Osteocrin_mouse

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	O09002
Sequence	SFSGFGSPLDRLSAGSVEHRGKQRKAVDHSKKRFGIPMDRIGRNRLSSSR

CAT#	Product Name	Inquiry
P6303	Z-Ala-Arg-Arg-AMC	Inquiry
X17445	SVTNP_Vpr	Inquiry
X20179	UP_P84465	Inquiry
X02963	PM_10612045	Inquiry
X08668	PM_17234686	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Palmitoyl Tripeptide-5

of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...

Delcasertib: A Novel δ-Protein Kinase C Inhibitor

Delcasertib, also known as KAI-9803, is a 23-amino acid peptide and δ-protein kinase C (δ-PKC) inhibitor. KAI-9 ...

Function of caprooyl tetrapeptide-3 in skin

Caprooyl tetrapeptide-3, an anti-wrinkle peptide, a reaction product of caproic acid and tetrapeptide-3, compris ...

Function of leuprolide acetate in disorders of the reproductive system

Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...

Effects of tripeptide-3 in skin

Neurotransmitter Inhibitor Peptides Peptides used in topical anti-aging products have multiple applications. Gorouhi and Maib ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Length	50
Modifications	Arginine amide