CAT# | C08187 |
M.W/Mr. | 3653.1 |
Sequence | GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD-NH2 |
Length | 33 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
C08023 | 53BP2 (490-498), p53-Binding Loop (CDB3) | Inquiry | ||
C08185 | p53 (65-73) | Inquiry | ||
C08186 | p53 Mutant Form (361-371), Pab 421 | Inquiry | ||
C08224 | [Lys(Ac)382]-p53 (372-389), biotin labeled | Inquiry | ||
C08178 | Nuclear Export Signal, NES p53 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
MEN 11270 (H-DArg-Arg-Pro-Hyp-Gly-Thi-c(Dab-Dtic-Oic-Arg)c(7γ-10α)) is a novel selective constrained peptide ant ...
Trimetazidine is a partial fatty acid oxidation inhibitor that inhibits 3-ketoacyl CoA thiolase, one of the enzymes of fatty ...
Abarelix, sold under the brand name Plenaxis, is a synthetic decapeptide and Gonadotropin-releasing hormone (GnR ...
Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...
Figure 1. The structural formula of montirelinMontirelin, an analog of thyrotrophin-releasing hormone (TRH) is m ...