PACAP (1-38), human, ovine, rat TFA

PACAP (1-38), human, ovine, rat TFA is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1592

Synonyms/Alias:Pituitary Adenylate Cyclase Activating Polypeptide 38 (TFA)

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₂₀₃H₃₃₁N₆₃O₅₃S.C₂HF₃O₂
M.W/Mr.
4648.28
Sequence
One Letter Code: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
three Letter Code: His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2

PACAP (1-38), human, ovine, rat TFA is a synthetic peptide corresponding to the full-length sequence of pituitary adenylate cyclase-activating polypeptide (PACAP) comprising 38 amino acids, with trifluoroacetate as the counterion. As a highly conserved neuropeptide, PACAP (1-38) is recognized for its significant role in neuroendocrine signaling, neurotransmission, and neuroprotection across multiple species including humans, sheep, and rats. Its broad physiological relevance and evolutionary conservation have made it an indispensable tool in peptide-based research, particularly in studies exploring G protein-coupled receptor signaling, neuropeptide function, and peptide-receptor interactions. The availability of this peptide in a chemically defined format supports detailed investigations into its mechanisms of action and functional diversity.

Receptor pharmacology: PACAP (1-38) is widely utilized in studies examining the activation and signaling dynamics of PAC1, VPAC1, and VPAC2 receptors, which are members of the class B G protein-coupled receptor family. Researchers employ the peptide to characterize receptor binding affinities, delineate downstream second messenger pathways such as cAMP accumulation, and assess receptor specificity. These investigations are crucial for understanding the molecular basis of neuropeptide-receptor interactions, mapping receptor distribution, and identifying potential modulatory mechanisms relevant to neuroendocrine communication.

Neuroscience research: The peptide serves as a key experimental tool for elucidating the physiological and pathophysiological roles of PACAP in central and peripheral nervous system function. Its application in in vitro and in vivo models enables detailed study of synaptic plasticity, neurogenesis, and neuroprotection. By modulating neuronal excitability and survival, PACAP (1-38) facilitates research into mechanisms underlying neurodevelopment, stress responses, and neuronal injury, providing insight into fundamental aspects of neural regulation.

Endocrine signaling studies: PACAP (1-38) is instrumental in investigating the regulation of hormone secretion and intracellular signaling cascades in various endocrine tissues. Its potent stimulatory effects on adenylate cyclase activity make it a valuable probe for dissecting the molecular events governing hormone release from pituitary, pancreatic, and adrenal cells. These studies advance understanding of neuropeptide-mediated control of endocrine function and the integration of neuroendocrine axes.

Peptide structure-function analysis: The full-length 38-residue sequence of PACAP enables detailed structure-activity relationship (SAR) studies, where modifications to specific amino acid residues or truncations can be compared to the native peptide. Such research supports the identification of critical determinants for receptor activation, selectivity, and biological efficacy. Insights gained from SAR analyses are essential for the rational design of peptide analogs and modulators with tailored pharmacological profiles.

Comparative and translational studies: The conserved sequence of PACAP (1-38) across human, ovine, and rat species allows for cross-species investigations into evolutionary aspects of neuropeptide function. Researchers leverage this peptide to compare signaling properties, receptor interactions, and physiological responses among different animal models, thereby enhancing the translational relevance of basic research findings. This comparative approach is particularly valuable for bridging preclinical studies with broader biological contexts and for validating mechanistic hypotheses across mammalian systems.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServicePeptide Analysis ServicesEpitope Mapping ServicesPeptide Synthesis ServicesPeptide Modification ServicesCustom Conjugation ServicePeptide CDMOPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers