PACAP 38, amide, frog

PACAP 38, amide, frog, displays a long peptide chain rich in helicogenic residues influencing receptor-binding research. Amphipathic regions assist in analyzing membrane-interaction patterns. Conformational adaptability provides insight into neuropeptide evolution. The peptide is widely applied in comparative biosynthesis and structural-function exploration.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: P08005

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.W/Mr.
4548.4
Sequence
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK-NH2
Length
38

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesPeptide Synthesis ServicesEpitope Mapping ServicesPeptide Nucleic Acids SynthesisPeptide CDMOCustom Conjugation ServicecGMP Peptide ServicePeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers