CAT# | AF2064 |
Sequence | SLWENFKNAGKQFILNILDKIRCRVAGGCRT |
Activity | Gram+ & Gram-, |
Host Chemicals | the broad-folded frog, Hylarana latouchii, China, Asia | Length | 31 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2227 | Brevinin-2JD | Inquiry | ||
AF1452 | Caerin-2.5 | Inquiry | ||
AF2424 | Andersonin-C peptide precursor | Inquiry | ||
AF1858 | Chain A, E6-Binding Zinc Finger (E6apc1) | Inquiry | ||
AF2234 | Brevinin-2-OR7 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...
Camstatin is a similar PEP-19 analogue with enhanced calmodulin binding and antagonism. It is a functional 25- ...
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...
Thymosin Thymosin is a hormone secreted from the thymus. This is the reason why it is named Thymosin. But most are now known ...