Home > Product > Antimicrobial Peptides > Palustrin-2LTa

Antimicrobial Peptides

Palustrin-2LTa

Price Inquiry
CAT#
AF2064
Sequence
SLWENFKNAGKQFILNILDKIRCRVAGGCRT
Host Chemicals
the broad-folded frog, Hylarana latouchii, China, Asia
Length
31
Activity
Gram+ & Gram-,

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.