Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLNNIGNTGCNEDEC |
Activity | Gram-, |
Host Chemicals | North America, Rana palustris |
Length | 48 |
SwissProt ID | SwissProt ID: P84281 |
1. High fat diet and GLP-1 drugs induce pancreatic injury in mice
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.