Keywords Search Google Search Search

Parathyroid Hormone (1-34), human, C-Terminal

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	P03001
M.W/Mr.	4604.3
Sequence	SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(FAM-)

CAT#	Product Name	Inquiry
P03010	[Tyr63] Parathyroid Hormone (63-84), human	Inquiry
P03021	(Tyr52,Asp76)-pTH (52-84) (human)	Inquiry
P03040	pTH-Related Protein (1-37) (human, mouse, rat)	Inquiry
P03028	pTH-Related Protein Splice Isoform 3 (140-173) (human)	Inquiry
P03009	(Tyr27)-pTH (27-48) (human)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Delmitide: A novel peptide with anti-inflammatory effect

Delmitide, also known as RDP58, is a novel D-amino acid decapeptide with anti-inflammatory effect. RDP58 is a te ...

A new kind of glycopeptide antibiotics–Ramoplanin

Ramoplanin is a new kind of glycopeptide antibiotics, which can inhibit the biosynthesis of the cell walls of gr ...

Function of Hexanoyl Dipeptide-3 Norleucine Acetate in Human Skin

Foreword We live in a photoshopped world, where we are constantly updated by images of digital perfection. It's easy to becom ...

Huwentoxin IV, A Kind of Selective NaV1.7 Channel Blocker

Huwentoxin IV, a 35-amino-acid-residue polypeptide from Chinese tarantula Ornithoctonus huwena venom, is a kind ...

Function of leuprolide acetate in disorders of the reproductive system

Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: