Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
M.W/Mr. | 4604.3 |
Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(FAM-) |
Length | 41 |
1. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
2. The spatiotemporal control of signalling and trafficking of the GLP-1R
4. TMEM16F and dynamins control expansive plasma membrane reservoirs
5. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.