Keywords Search Google Search Search

Pardaxin 2

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2181
Sequence	GFFALIPKIISSPIFKTLLSAVGSALSSSGGQE
Activity	Antimicrobial

CAT#	Product Name	Inquiry
AF1158	Hymenochirin-5Pg	Inquiry
AF1238	Gaegurin-LK1	Inquiry
AF1836	Cathelicidin-PY	Inquiry
AF1377	Antimicrobial peptide D5	Inquiry
AF329	Eumenine mastoparan-OD	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

ProTx II, a selective inhibitor of NaV1.7 sodium channel

ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...

The application of obestatin (human) in hormonal therapy

Obestatin is a 23-amino acid peptide hormone produced in specific epithelial cells of the stomach and small inte ...

Function of sinapultide in respiratory distress syndrome

Sinapultide (also known as KL4 peptide) is a synthetic protein used to mimic human SP-B. Respiratory distress ...

The Function of Aviptadil Acetate on the Treatment of Pulmonary Arterial Hypertension

Aviptadil acetate, the nonproprietary or generic name for a vasoactive intestinal peptide (VIP), is a synthetic ...

The mechanism of R18 on 14-3-3 protein

R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Pardachirus pavoninus
Length	33