Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GGSVPCGESCVFIPCITSLAGCSCKNKVCYYD |
Activity | Insects, Mammalian cells, |
Host Chemicals | Palicourea rigida (Rubiaceae) |
Length | 32 |
1. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
2. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.