Home > Product > Antimicrobial Peptides > Pediocin PA-1

Antimicrobial Peptides

Pediocin PA-1

Price Inquiry
CAT#
AF2475
Sequence
YYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATG
Host Chemicals
Synthetic construct
Length
35
Activity
Antibacterial

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.