Home > Product > Antimicrobial Peptides > Penaeidin-2a

Antimicrobial Peptides

Penaeidin-2a

Price Inquiry
CAT#
AF3277
Sequence
YRGGYTGPIPRPPPIGRPPFRPVCNACYRLSVSDARNCCIKFGSCCHLVK
Host Chemicals
Penoeid shrimp, Penaeus vannamei
Length
50
Activity
Gram+, Fungi,
SwissProt ID
SwissProt ID: P81057

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.