CAT# | P04003 |
M.F/Formula | C194H295N55O57 |
M.W/Mr. | 4309.81 |
Sequence | YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
Length | 36 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
P04004 | (Leu31,Pro34)-Peptide YY (human) | Inquiry | ||
P04006 | Peptide YY (3-36) (canine, mouse, porcine, rat) | Inquiry | ||
P04002 | Peptide YY (canine, mouse, porcine, rat) | Inquiry | ||
P04005 | (Pro34)-Peptide YY (human) | Inquiry | ||
P04001 | Peptide YY (13-36), porcine | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Glucagon is a 29-amino acid peptide hormone that is synthesized in pancreatic α cells from the proglucagon precursor by proho ...
Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...
The 70-kDa heat shock protein (HSP70) contains three domains: the ATPase N-domain, which hydrolyses ATP, the sub ...
of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...
The peptide neuroprotectant Tat-NR2B9c, also known as NA-1, is a Tat peptide consisting of the nine C-terminal ...