Effective voltage-gated sodium channels blocker
(IC50 values are 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively) that blocks inward sodium currents in a voltage-dependent manner.
CAT# | R1061 |
CAS | 880886-00-0 |
M.F/Formula | C176H269N51O48S6 |
M.W/Mr. | 4059.74 |
Sequence | DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI(Modifications: Disulfide bridges: 2-17,9-23,16-30) |
Labeling Target | Sodium channels |
Appearance | White lyophilised solid |
Purity | >99% |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The peptide Difopein, designed, isolated and identified by Haian Fu, is a high affinity inhibitor of 14-3-3 pro ...
Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...
Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...
In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...
Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...