Phrixotoxin 3-NH2 TFA

Phrixotoxin 3-NH2 TFA is a spider-venom peptide stabilized by multiple disulfide bonds, providing a rigid scaffold for ion-channel studies. Basic and hydrophobic residues form complementary surfaces for voltage-gated channel binding. Researchers characterize its structure via NMR and electrophysiological assays. Applications include toxin-motif research, channel selectivity mapping, and disulfide-rich peptide engineering.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2854

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C176H270N52O47S6.xC2HF3O2
M.W/Mr.
4058.74 (free base)
Sequence
One Letter Code:DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys23;Cys16-Cys30)
Three Letter Code:Asp-Cys-Leu-Gly-Phe-Leu-Trp-Lys-Cys-Asn-Pro-Ser-Asn-Asp-Lys-Cys-Cys-Arg-Pro-Asn-Leu-Val-Cys-Ser-Arg-Lys-Asp-Lys-Trp-Cys-Lys-Tyr-Gln-Ile-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys23;Cys16-Cys30)

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServiceEpitope Mapping ServicesPeptide CDMOPeptide Nucleic Acids SynthesiscGMP Peptide ServicePeptide Modification ServicesPeptide Analysis ServicesPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers