Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C176H270N52O47S6.xC2HF3O2 |
M.W/Mr. | 4058.74 (free base) |
Sequence | One Letter Code:DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys23;Cys16-Cys30) Three Letter Code:Asp-Cys-Leu-Gly-Phe-Leu-Trp-Lys-Cys-Asn-Pro-Ser-Asn-Asp-Lys-Cys-Cys-Arg-Pro-Asn-Leu-Val-Cys-Ser-Arg-Lys-Asp-Lys-Trp-Cys-Lys-Tyr-Gln-Ile-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys23;Cys16-Cys30) |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.