Phrixotoxin 3-NH2 TFA

Phrixotoxin 3-NH2 TFA is a spider-venom peptide stabilized by multiple disulfide bonds, providing a rigid scaffold for ion-channel studies. Basic and hydrophobic residues form complementary surfaces for voltage-gated channel binding. Researchers characterize its structure via NMR and electrophysiological assays. Applications include toxin-motif research, channel selectivity mapping, and disulfide-rich peptide engineering.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2854

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C176H270N52O47S6.xC2HF3O2
M.W/Mr.
4058.74 (free base)
Sequence
One Letter Code:DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys23;Cys16-Cys30)
Three Letter Code:Asp-Cys-Leu-Gly-Phe-Leu-Trp-Lys-Cys-Asn-Pro-Ser-Asn-Asp-Lys-Cys-Cys-Arg-Pro-Asn-Leu-Val-Cys-Ser-Arg-Lys-Asp-Lys-Trp-Cys-Lys-Tyr-Gln-Ile-NH2 (Disulfide bridge:Cys2-Cys17;Cys9-Cys23;Cys16-Cys30)

Phrixotoxin 3-NH2 TFA is a synthetic peptide derivative modeled after the naturally occurring phrixotoxin 3, a member of the spider toxin family known for its selective modulation of voltage-gated ion channels. As a peptide compound, it features an amidated C-terminus and is commonly supplied as a trifluoroacetate (TFA) salt to enhance stability and solubility for laboratory use. Its unique amino acid sequence and structural motifs make it a valuable tool for probing the functional architecture of ion channels, particularly those implicated in neuronal excitability and signal transduction. Researchers utilize this compound to dissect the molecular mechanisms underlying channel gating, pharmacology, and toxin-channel interactions, contributing to a deeper understanding of neurophysiological processes and ion channelopathies.

Electrophysiological research: Phrixotoxin 3-NH2 is extensively applied in electrophysiological studies to investigate the function and pharmacological properties of voltage-gated sodium and potassium channels. By selectively binding to specific channel subtypes, it enables precise modulation of ionic currents in neuronal and cardiac preparations. This targeted activity provides a reliable means to characterize channel kinetics, gating mechanisms, and the effects of mutations or auxiliary subunits on channel behavior, supporting the development of detailed electrophysiological profiles.

Ion channel pharmacology: The peptide serves as a potent molecular probe in ion channel pharmacology, allowing researchers to map toxin binding sites and elucidate structure-activity relationships within channel proteins. Its high affinity and selectivity facilitate the identification of critical residues involved in toxin-channel interactions, which is instrumental in guiding the rational design of channel modulators and advancing the field of toxin-inspired pharmacological tool development.

Neurobiology studies: In neurobiological research, phrixotoxin 3 analogs are invaluable for dissecting the roles of specific sodium and potassium channel isoforms in neuronal signaling pathways. By selectively inhibiting or modulating channel activity, the compound helps clarify the contribution of individual channel types to action potential generation, synaptic transmission, and neuronal plasticity. Such studies provide foundational insights into the molecular basis of excitability and information processing in neural circuits.

Peptide structure-function analysis: The unique sequence and three-dimensional conformation of this peptide enable detailed structure-function analyses through techniques such as NMR spectroscopy, X-ray crystallography, and molecular modeling. Researchers employ these approaches to understand the relationship between specific amino acid residues, structural motifs, and biological activity, informing the broader field of toxin-based peptide engineering and the design of novel bioactive molecules.

Peptide synthesis and modification studies: As a chemically defined peptide, phrixotoxin 3-NH2 TFA is frequently used as a reference standard or starting scaffold in synthetic peptide research. Its well-characterized framework supports the development of analogs with altered pharmacological profiles, improved stability, or enhanced selectivity. Such work underpins advances in peptide chemistry, including methods for site-specific modification, backbone cyclization, and the incorporation of noncanonical amino acids, thereby expanding the toolkit available for functional studies and molecular innovation.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesPeptide Synthesis ServicesPeptide CDMOcGMP Peptide ServiceEpitope Mapping ServicesPeptide Modification ServicesCustom Conjugation ServicePeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers