Phrixotoxin 3

Effective voltage-gated sodium channels blocker
(IC50 values are 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively) that blocks inward sodium currents in a voltage-dependent manner.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1061

CAS No:880886-00-0

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C176H269N51O48S6
M.W/Mr.
4059.74
Sequence
DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI(Modifications: Disulfide bridges: 2-17,9-23,16-30)
Labeling Target
Sodium channels
Appearance
White lyophilised solid
Purity
>99%
Activity
Blocker

Phrixotoxin 3 is a peptide toxin originally isolated from the venom of the Chilean tarantula Phrixotrichus auratus, and it is recognized for its potent and selective modulation of voltage-gated sodium channels, particularly those in the Nav1.2 and Nav1.5 subfamilies. As a member of the spider toxin peptide family, Phrixotoxin 3 features a compact, disulfide-rich structure that confers both stability and high affinity for its molecular targets. The unique pharmacological profile of this peptide has made it a valuable tool for researchers studying the functional dynamics of ion channels in excitable cells. Its specificity and mechanism of action provide significant advantages for dissecting the physiological and pathophysiological roles of sodium channels in neuronal and cardiac tissues.

Electrophysiology research: Phrixotoxin 3 is widely used in electrophysiological studies to probe the gating mechanisms and subtype-selective properties of voltage-gated sodium channels. By selectively inhibiting certain channel isoforms, the peptide enables detailed characterization of channel kinetics, voltage dependence, and pharmacological sensitivities in heterologous expression systems or native tissues. This application is essential for understanding the molecular determinants of channel function and for mapping the contributions of specific sodium channel subtypes to action potential generation and propagation.

Ion channel drug discovery: The selective binding and inhibitory profile of this spider toxin make it a valuable reference compound in the screening and validation of novel sodium channel modulators. In preclinical research, it serves as a benchmark for evaluating the efficacy and selectivity of small molecules or biologics targeting Nav1.2, Nav1.5, and related channel variants. The precise mode of action of the peptide supports the identification of allosteric modulatory sites and aids in the rational design of next-generation ion channel therapeutics for neurological and cardiac research applications.

Neurophysiology studies: Researchers utilize Phrixotoxin 3 to dissect the individual contributions of specific sodium channel isoforms in neuronal excitability, synaptic transmission, and network activity. Its ability to distinguish between closely related channel subtypes allows for the functional mapping of sodium channel distribution and the elucidation of their roles in shaping neuronal firing patterns. This is particularly valuable in studies investigating the molecular basis of excitability disorders or the physiological underpinnings of synaptic plasticity.

Cardiac electrophysiology: In cardiac research, the peptide is employed to investigate the role of Nav1.5 channels in cardiac myocyte action potential initiation and conduction. By selectively inhibiting these channels, scientists can assess the impact on cardiac excitability, arrhythmogenic potential, and the mechanisms underlying electrical conduction disorders. These studies provide critical insights into the molecular basis of cardiac rhythm regulation and the development of arrhythmias.

Structure-function analysis: The well-defined structure of Phrixotoxin 3, combined with its high specificity for target sodium channels, makes it an excellent molecular probe for structure-function studies. Researchers leverage its interactions to identify key amino acid residues and structural motifs involved in toxin binding and channel modulation. Such analyses advance the understanding of both channel architecture and the principles governing peptide-channel recognition, supporting broader efforts in rational drug design and bioengineering of ion channel modulators.

Source#
Synthetic
InChI
InChI=1S/C176H269N51O48S6/c1-11-91(10)141(174(274)275)225-150(250)108(52-53-132(183)231)203-153(253)114(67-93-48-50-96(230)51-49-93)208-145(245)104(41-21-26-56-179)202-163(263)125-82-277-280-85-128-168(268)222-126-83-278-276-81-124(218-142(242)99(182)70-137(236)237)165(265)205-110(63-87(2)3)143(243)195-78-136(235)196-113(66-92-33-13-12-14-34-92)152(252)206-111(64-88(4)5)151(251)210-115(68-94-76-193-100-37-17-15-35-97(94)100)154(254)198-105(42-22-27-57-180)148(248)219-127(166(266)215-121(73-135(186)234)173(273)227-62-32-47-131(227)170(270)217-123(80-229)162(262)211-117(71-133(184)232)156(256)213-120(75-139(240)241)159(259)200-106(149(249)220-128)43-23-28-58-181)84-279-281-86-129(223-171(271)140(90(8)9)224-160(260)112(65-89(6)7)207-157(257)118(72-134(185)233)214-169(269)130-46-31-61-226(130)172(272)109(204-164(126)264)45-30-60-192-176(189)190)167(267)216-122(79-228)161(261)201-107(44-29-59-191-175(187)188)144(244)197-102(39-19-24-54-177)147(247)212-119(74-138(238)239)158(258)199-103(40-20-25-55-178)146(246)209-116(155(255)221-125)69-95-77-194-101-38-18-16-36-98(95)101/h12-18,33-38,48-51,76-77,87-91,99,102-131,140-141,193-194,228-230H,11,19-32,39-47,52-75,78-86,177-182H2,1-10H3,(H2,183,231)(H2,184,232)(H2,185,233)(H2,186,234)(H,195,243)(H,196,235)(H,197,244)(H,198,254)(H,199,258)(H,200,259)(H,201,261)(H,202,263)(H,203,253)(H,204,264)(H,205,265)(H,206,252)(H,207,257)(H,208,245)(H,209,246)(H,210,251)(H,211,262)(H,212,247)(H,213,256)(H,214,269)(H,215,266)(H,216,267)(H,217,270)(H,218,242)(H,219,248)(H,220,249)(H,221,255)(H,222,268)(H,223,271)(H,224,260)(H,225,250)(H,236,237)(H,238,239)(H,240,241)(H,274,275)(H4,187,188,191)(H4,189,190,192)
InChI Key
SOKDRDMJNDICMO-UHFFFAOYSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOPeptide Analysis ServicesPeptide Synthesis ServicesPeptide Nucleic Acids SynthesisCustom Conjugation ServiceEpitope Mapping ServicesPeptide Modification ServicescGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers