CAT# | P15001 |
Sequence | LYCEPNTRFKQECNWCTCSANGEYATCTLLYCGPR |
Length | 35 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
P15017 | serine protease inhibitor pi-4Ca | Inquiry | ||
P15015 | serine protease inhibitor pi-4A | Inquiry | ||
P15006 | protease inhibitor SGPI-5A | Inquiry | ||
P15005 | protease inhibitor PI-8 | Inquiry | ||
P15018 | serine protease inhibitor pi-4Cp | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...
Ganirelix, a synthetic decapeptide compound, is a gonadotrophin-releasing hormone (GnRH) antagonist preparation ...
Catestain, a 21 amino acid fragment of chromogranin A (CgA), is divided into human CgA352-372 and bovine CgA344- ...
Acetyl pepstatin, nature products of yeast fermentation, is general inhibitors of the family of aspartic proteas ...
The Discovery of Somatostatin Somatostatin (SS) is an endogenous peptide hormone isolated, purified and characterized in 1973 ...