Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | LYCEPNTRFKQECNWCTCSANGEYATCTLLYCGPR |
Length | 35 |
1. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
2. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
4. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
5. Cationic cell-penetrating peptides are potent furin inhibitors
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.