Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | VFHAYSARGNYYGNCPANWPSCRNNYKSAGGK |
Activity | Gram+ & Gram-, |
Host Chemicals | Lactobacillus plantarum 163 |
Length | 32 |
4. Emu oil in combination with other active ingredients for treating skin imperfections
5. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.