Home > Product > Antimicrobial Peptides > Ponericin-G1

Antimicrobial Peptides

Ponericin-G1

Price Inquiry
CAT#
AF1954
Sequence
GWKDWAKKAGGWLKKKGPGMAKAALKAAMQ
Host Chemicals
Pachycondyla goeldii
Length
30
Activity
Antibacterial, Antifungal
SwissProt ID
P82414

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.