Ponericin-G1

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: AF1954

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
Sequence
GWKDWAKKAGGWLKKKGPGMAKAALKAAMQ
Activity
Antibacterial, Antifungal
Host Chemicals
Pachycondyla goeldii
Length
30
SwissProt ID
P82414

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicescGMP Peptide ServicePeptide Nucleic Acids SynthesisEpitope Mapping ServicesPeptide CDMOPeptide Analysis ServicesCustom Conjugation ServicePeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers