Preptin, Human Pro-Insulin Growth Factor II (67-100), rat

Preptin, Human Pro-Insulin Growth Factor II (67-100), rat aligns with the rat homolog of the prohormone-derived regulatory segment. The peptide contains motifs affecting secretion, folding, and downstream signaling. Researchers employ it to compare species-specific processing and conformational tendencies. Its defined boundaries support studies on precursor maturation and peptide-protein interactions.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: I02007

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.W/Mr.
3932.4
Sequence
DVSTSQAVLPDDFPRYPVGKFFKFDTWRQSAGRL
Length
34

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesCustom Conjugation ServicePeptide Synthesis ServicesPeptide Modification ServicesEpitope Mapping ServicesPeptide Nucleic Acids SynthesiscGMP Peptide ServicePeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers