Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C226H343N61O64S |
M.W/Mr. | 4970.63 |
Sequence | YAPGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ |
2. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.