Keywords Search Google Search Search

protease inhibitor PI-8

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	P15005
Sequence	QVNCTPGTTFKDKCNTCRCSSNGRSAACTLKACPPGSY

CAT#	Product Name	Inquiry
P15015	serine protease inhibitor pi-4A	Inquiry
P15007	protease inhibitor SGPI-5Bt	Inquiry
P15002	PI2	Inquiry
P15016	serine protease inhibitor pi-4B	Inquiry
P15006	protease inhibitor SGPI-5A	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of FC 131 as CXCR4 antagonists

The cyclopentapeptide FC 131 (cyclo(-L-Arg1-L-Arg2-L-2-Nal3-Gly4-D-Tyr5-), 2-Nal=3-(2-naphthyl) alanine)) is an ...

Bovine Pancreatic Trypsin Inhibitor (BPTI)-Aprotinin

Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...

What is GHK and Copper Peptide?

Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be accomplished b ...

Novel Peptide Drugs Treat Multiple Diseases (Part One)

Peptides are the ideal drug molecules because of their high affinity, high selectivity, low toxicity, and easy synthesis. Sci ...

Function of Timonacic in Cancer

Timonacic's chemical name, L-Syrosin-4, is a new anti-tumor drug that converts cancer cells into normal cells. E ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: