Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C195H316N58O54S2 |
M.W/Mr. | 4401.15 |
Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL |
Length | 37 |
2. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
4. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.